PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010105533.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family BBR-BPC
Protein Properties Length: 281aa    MW: 31153.8 Da    PI: 10.1664
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010105533.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind350.34.2e-10712811301
       GAGA_bind   1 mdddgsrernkgyyepaaslkenlglqlmssiaerdaki....rernlalsekkaavaerd.........maflqrdkalaernkalverdnkll 82 
                     mddd+ + rn+gyyep+  +k +lglqlmss+aerd+k+    r+  + + + ++a+++rd         m++  rd+++++        ++k+l
  XP_010105533.1   1 MDDDALNMRNWGYYEPT--FKGHLGLQLMSSMAERDTKPymsgRDPTTVMVSANGAFHPRDcvvsdapvpMNY-VRDSWVNQ--------RDKFL 84 
                     9***9999*******99..************************999999************************.9******9........789** PP

       GAGA_bind  83 alllvenslasalpvgvqvlsgtksidslqqlsepqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkkkkksekskkk 177
                     ++l+       a+p++  vl++t+ ++slq+     l+++ +  r+e    +  +ee + ++ke+  +kkrq +  pk++k k+++k    +k++
  XP_010105533.1  85 NMLP-------ANPNYAPVLPETSGAHSLQM-----LQPPETT-RDE---RVGRVEEPVIVNKESGPSKKRQGGGAPKAPKVKRPRK----PKDN 159
                     ***9.......4688999*************.....4444333.333...35677788888999999999999*******9999999....3344 PP

       GAGA_bind 178 vkkesaderskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekL 272
                     ++++   +r+k  kks+++v+ng+++D+s++P+PvCsCtG+++qCY+WG+GGWqSaCCtt++SvyPLP+stkrrgaRiagrKmSqgafkk+LekL
  XP_010105533.1 160 TNPAV--PRVKPAKKSLEVVINGIDMDISGIPIPVCSCTGTPQQCYRWGCGGWQSACCTTNVSVYPLPMSTKRRGARIAGRKMSQGAFKKVLEKL 252
                     44444..789************************************************************************************* PP

       GAGA_bind 273 aaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                     aaeGy+++np+DL++hWA+HGtnkfvtir
  XP_010105533.1 253 AAEGYNFANPIDLRTHWARHGTNKFVTIR 281
                     ****************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF062173.6E-1151281IPR010409GAGA-binding transcriptional activator
SMARTSM012264.4E-1841281IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0050793Biological Processregulation of developmental process
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MDDDALNMRN WGYYEPTFKG HLGLQLMSSM AERDTKPYMS GRDPTTVMVS ANGAFHPRDC  60
VVSDAPVPMN YVRDSWVNQR DKFLNMLPAN PNYAPVLPET SGAHSLQMLQ PPETTRDERV  120
GRVEEPVIVN KESGPSKKRQ GGGAPKAPKV KRPRKPKDNT NPAVPRVKPA KKSLEVVING  180
IDMDISGIPI PVCSCTGTPQ QCYRWGCGGW QSACCTTNVS VYPLPMSTKR RGARIAGRKM  240
SQGAFKKVLE KLAAEGYNFA NPIDLRTHWA RHGTNKFVTI R
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00253DAPTransfer from AT2G01930Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010105533.10.0hypothetical protein L484_019276
SwissprotQ9SKD01e-114BPC1_ARATH; Protein BASIC PENTACYSTEINE1
TrEMBLW9SG760.0W9SG76_9R
STRINGVIT_01s0011g06380.t011e-157(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23703283
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14685.31e-112basic pentacysteine 2